LOCUS Exported 2984 bp ds-DNA circular SYN 16-FEB-2017 DEFINITION synthetic circular DNA ACCESSION . VERSION . KEYWORDS pAd1127-02 SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2984) AUTHORS . TITLE Direct Submission JOURNAL Exported Thursday, Feb 16, 2017 from SnapGene 3.3.3 http://www.snapgene.com FEATURES Location/Qualifiers source 1..2984 /organism="synthetic DNA construct" /lab_host="Escherichia coli" /mol_type="other DNA" repeat_region 4..106 /label=Ad5 left ITR /note="Ad5 left ITR" /note="ITR" promoter 67..75 /note="ATF binding site" misc_feature 243..251 /function="Ad5 genome packaging" /note="A1" /note="- A1 repeat - consensus sequence: 5'-TTTG-N8-CG-3' - Ostapchuk and Hearing (2005) J Cell Biochem. 96:25-35" misc_feature 263..272 /function="Ad5 genome packaging" /note="A2" /note="- A2 repeat - consensus sequence: 5'-TTTG-N8-CG-3' - Ostapchuk and Hearing (2005) J Cell Biochem. 96:25-35" misc_feature 305..314 /function="Ad5 DNA packaging" /note="A3" /note="- A3 repeat - Ostapchuk and Hearing (2005) J Cell Biochem. 96:25-35" misc_feature 316..324 /function="Ad5 DNA packaging" /note="A4" /note="- A4 repeat - Ostapchuk and Hearing (2005) J Cell Biochem. 96:25-35" misc_feature 340..349 /function="Ad5 DNA packaging" /note="A5" /note="- A5 repeat - consensus sequence: 5'-TTTG-N8-CG-3' - Ostapchuk and Hearing (2005) J Cell Biochem. 96:25-35" CDS 525..947 /codon_start=1 /gene="pIX" /product="Ad5 pIX" /label=Ad5 pIX /note="Ad5 pIX" /db_xref="GI:33465835" /protein_id="AAQ19288.1" /translation="MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANST TLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTALL AQLDSLTRELNVVSQQLLDLRQQVSALKASSPPNAV" rep_origin complement(1023..1611) /direction=LEFT /note="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1786..2601) /codon_start=1 /product="Kanamycin-R" /label=Kanamycin-R /note="Kanamycin-R" /note="origin: Tn903" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" misc_signal 2664..2911 /label=Cos site /note="Cos site" /note="phage lambda COS site" ORIGIN 1 taacatcatc aataatatac cttattttgg attgaagcca atatgataat gagggggtgg 61 agtttgtgac gtggcgcggg gcgtgggaac ggggcgggtg acgtagtagt gtggcggaag 121 tgtgatgttg caagtgtggc ggaacacatg taagcgacgg atgtggcaaa agtgacgttt 181 ttggtgtgcg ccggtgtaca caggaagtga caattttcgc gcggttttag gcggatgttg 241 tagtaaattt gggcgtaacc gagtaagatt tggccatttt cgcgggaaaa ctgaataaga 301 ggaagtgaaa tctgaataat tttgtgttac tcatagcgcg taatatttgt ctagggagat 361 cttctagacc cgggagcggc cgctgtcgac ctgcaggatc cgaattcgat atcactagtg 421 gtaccagtac tgaaatgtgt gggcgtggct taagggtggg aaagaatata taaggtgggg 481 gtcttatgta gttttgtatc tgttttgcag cagccgccgc cgccatgagc accaactcgt 541 ttgatggaag cattgtgagc tcatatttga caacgcgcat gcccccatgg gccggggtgc 601 gtcagaatgt gatgggctcc agcattgatg gtcgccccgt cctgcccgca aactctacta 661 ccttgaccta cgagaccgtg tctggaacgc cgttggagac tgcagcctcc gccgccgctt 721 cagccgctgc agccaccgcc cgcgggattg tgactgactt tgctttcctg agcccgcttg 781 caagcagtgc agcttcccgt tcatccgccc gcgatgacaa gttgacggct cttttggcac 841 aattggattc tttgacccgg gaacttaatg tcgtttctca gcagctgttg gatctgcgcc 901 agcaggtttc tgccctgaag gcttcctccc ctcccaatgc ggtttaacgg tccgggccag 961 agtggccgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg 1021 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg 1081 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg 1141 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga 1201 agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc 1261 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt 1321 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact 1381 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg 1441 cctaactacg gctacactag aagaacagta tttggtatct gcgctctgct gaagccagtt 1501 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt 1561 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct 1621 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg 1681 gtcatgagat tatcaaaaag gatcttcggc caagaaggcc agagtggcag agactgcatt 1741 cgaaaacgtt tgaattgata attattatca tttgcgggtc aattcttaga aaaactcatc 1801 gagcatcaaa tgaaactgca atttattcat atcaggatta tcaataccat atttttgaaa 1861 aagccgtttc tgtaatgaag gagaaaactc accgaggcag ttccatagga ttgcaagatc 1921 ctggtatcgg tctgcgattc cgactcgtcc aacatcaata caacctatta atttcccctc 1981 gtcaaaaata aggttatcaa gtgagaaatc accatgagtg acgactgaat ccggtgagaa 2041 tggcaaaagc ttatgcattt ctttccagac ttgttcaaca ggccagccat tacgctcgtc 2101 atcaaaatca ctcgcatcaa ccaaaccgtt attcattcgt gattgcgcct gagcgagacg 2161 aaatacgcga tcgctgttaa aaggacaatt acaaacagga atcgaatgca accggcgcag 2221 gaacactgcc agcgcatcaa caatattttc acctgaatca ggatattctt ctaatacctg 2281 gaatgctgtt ttcccgggga tcgcagtggt gagtaaccat gcatcatcag gagtacggat 2341 aaaatgcttg atggtcggaa gaggcataaa ttccgtcagc cagtttagtc tgaccatctc 2401 atctgtaaca tcattggcaa cgctaccttt gccatgtttc agaaacaact ctggcgcatc 2461 gggcttccca tacaatcgat agattgtcgc acctgattgc ccgacattat cgcgagccca 2521 tttataccca tataaatcag catccatgtt ggaatttaat cgcggcctcg agcaagacgt 2581 ttcccgttga atatggctca taacacccct tgtattactg tttatgtaag cagacagttt 2641 tattgttcat gcgaaaacgt ttgaattgat aattattatc atttgcgggt cctttccggc 2701 gatccgcctt gttacggggc ggcgacctcg cgggttttcg ctatttatga aaattttccg 2761 gtttaaggcg tttccgttct tcttcgtcat aacttaatgt ttttatttaa aataccctct 2821 gaaaagaaag gaaacgacag ctgaaagcga gctttttggc ctctgtcgtt tcctttctct 2881 gtttttgtcc gtggaatgaa caatggaagt cggcctcgtg atacgcctat ttttataggt 2941 taatgtcatg ataataatgg tttcttagcg atatttaaat taat //